Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (157 PDB entries) |
Domain d2bvob1: 2bvo B:1-99 [129290] Other proteins in same PDB: d2bvoa1, d2bvoa2 automatically matched to d1a9bb_ |
PDB Entry: 2bvo (more details), 1.65 Å
SCOP Domain Sequences for d2bvob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvob1 b.1.1.2 (B:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2bvob1: