SCOPe 2.03: Domain d2bvnb3: 2bvn B:6-204

Lineage for d2bvnb3 (2bvn B:6-204)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (9 PDB entries)
   Uniprot P02990

8. Domain d2bvnb3: 2bvn B:6-204 [129287]
   Other proteins in same PDB: d2bvna1, d2bvna2, d2bvnb1, d2bvnb2
   automated match to d1efca3
   complexed with enx, gnp, mg

Details for d2bvnb3

PDB Entry: 2bvn, 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia

PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d2bvnb3:

Sequence, based on SEQRES records:

>d2bvnb3 c.37.1.8 (B:6-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitints
hveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqv
gvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewe
akilelagfldsyipeper

Sequence, based on observed residues (ATOM records):

>d2bvnb3 c.37.1.8 (B:6-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
ertkphvnvgtighvdhgkttltaaittvlaktygargitintshveydtptrhyahvdc
pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd
deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe
per

Timeline for d2bvnb3:

• d2bvnb3 first appeared in SCOP 1.73
  
• d2bvnb3 appears in SCOPe 2.02
  
• d2bvnb3 appears in SCOPe 2.04
  
• d2bvnb3 appears in the current release, SCOPe 2.08