Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Escherichia coli [TaxId:562] [50450] (7 PDB entries) Uniprot P02990 |
Domain d2bvnb1: 2bvn B:205-296 [129285] Other proteins in same PDB: d2bvna2, d2bvna3, d2bvnb2, d2bvnb3 automated match to d1efca1 complexed with enx, gnp, mg |
PDB Entry: 2bvn (more details), 2.3 Å
SCOPe Domain Sequences for d2bvnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvnb1 b.43.3.1 (B:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d2bvnb1: