Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.2: Adenovirus hexon [49753] (2 proteins) each domain is heavily decorated with many insertions |
Protein Adenovirus hexon [63404] (2 species) |
Species Human adenovirus type 5 [TaxId:28285] [49756] (3 PDB entries) |
Domain d2bvip2: 2bvi P:637-946 [129279] |
PDB Entry: 2bvi (more details), 10 Å
SCOPe Domain Sequences for d2bvip2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvip2 b.121.2.2 (P:637-946) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]} tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie tvylrtpfsa
Timeline for d2bvip2: