Lineage for d2bvio2 (2bvi O:637-946)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679605Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 679635Superfamily b.121.2: Group II dsDNA viruses VP [49749] (3 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 679657Family b.121.2.2: Adenovirus hexon [49753] (1 protein)
    each domain is heavily decorated with many insertions
  6. 679658Protein Adenovirus hexon [63404] (2 species)
  7. 679662Species Human adenovirus type 5 [TaxId:28285] [49756] (2 PDB entries)
  8. 679684Domain d2bvio2: 2bvi O:637-946 [129277]
    automatically matched to d1p30a2

Details for d2bvio2

PDB Entry: 2bvi (more details)

PDB Description: The quasi-atomic model of Human Adenovirus type 5 capsid (Part 1)
PDB Compounds: (O:) hexon protein

SCOP Domain Sequences for d2bvio2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvio2 b.121.2.2 (O:637-946) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa

SCOP Domain Coordinates for d2bvio2:

Click to download the PDB-style file with coordinates for d2bvio2.
(The format of our PDB-style files is described here.)

Timeline for d2bvio2: