SCOPe 2.08: Domain d2bvio2: 2bvi O:637-946

Lineage for d2bvio2 (2bvi O:637-946)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.2: Adenovirus hexon [49753] (3 proteins)
   each domain is heavily decorated with many insertions

6. Protein Adenovirus hexon, C-terminal domain [418931] (2 species)

7. Species Human adenovirus type 5 [TaxId:28285] [419365] (3 PDB entries)

8. Domain d2bvio2: 2bvi O:637-946 [129277]
   Other proteins in same PDB: d2bvif1, d2bvig1, d2bvih1, d2bvii1, d2bvij1, d2bvik1, d2bvil1, d2bvim1, d2bvin1, d2bvio1, d2bvip1, d2bviq1

Details for d2bvio2

PDB Entry: 2bvi, 10 Å

PDB Description: The quasi-atomic model of Human Adenovirus type 5 capsid (Part 1)

PDB Compounds: (O:) hexon protein

SCOPe Domain Sequences for d2bvio2:

Sequence; same for both SEQRES and ATOM records:

>d2bvio2 b.121.2.2 (O:637-946) Adenovirus hexon, C-terminal domain {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa

Timeline for d2bvio2:

• d2bvio2 first appeared in SCOP 1.73
  
• d2bvio2 appears in SCOPe 2.07