Lineage for d2bvil2 (2bvi L:637-946)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. Family b.121.2.2: Adenovirus hexon [49753] (3 proteins)
    each domain is heavily decorated with many insertions
  6. Protein Adenovirus hexon, C-terminal domain [418931] (2 species)
  7. Species Human adenovirus type 5 [TaxId:28285] [419365] (3 PDB entries)
  8. Domain d2bvil2: 2bvi L:637-946 [129271]
    Other proteins in same PDB: d2bvif1, d2bvig1, d2bvih1, d2bvii1, d2bvij1, d2bvik1, d2bvil1, d2bvim1, d2bvin1, d2bvio1, d2bvip1, d2bviq1

Details for d2bvil2

PDB Entry: 2bvi (more details), 10 Å

PDB Description: The quasi-atomic model of Human Adenovirus type 5 capsid (Part 1)
PDB Compounds: (L:) hexon protein

SCOPe Domain Sequences for d2bvil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvil2 b.121.2.2 (L:637-946) Adenovirus hexon, C-terminal domain {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa

SCOPe Domain Coordinates for d2bvil2 are not available.

Timeline for d2bvil2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvil1