Lineage for d2bvil1 (2bvi L:5-636)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. Family b.121.2.2: Adenovirus hexon [49753] (3 proteins)
    each domain is heavily decorated with many insertions
  6. Protein Adenovirus hexon, N-terminal domain [418930] (2 species)
  7. Species Human adenovirus type 5 [TaxId:28285] [419364] (3 PDB entries)
  8. Domain d2bvil1: 2bvi L:5-636 [129270]
    Other proteins in same PDB: d2bvif2, d2bvig2, d2bvih2, d2bvii2, d2bvij2, d2bvik2, d2bvil2, d2bvim2, d2bvin2, d2bvio2, d2bvip2, d2bviq2
    has additional subdomain(s) that are not in the common domain

Details for d2bvil1

PDB Entry: 2bvi (more details), 10 Å

PDB Description: The quasi-atomic model of Human Adenovirus type 5 capsid (Part 1)
PDB Compounds: (L:) hexon protein

SCOPe Domain Sequences for d2bvil1:

Sequence, based on SEQRES records: (download)

>d2bvil1 b.121.2.2 (L:5-636) Adenovirus hexon, N-terminal domain {Human adenovirus type 5 [TaxId: 28285]}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitkegiq
igvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptneng
gqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthisympt
ikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrn
telsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvintet
ltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialylpdkl
kyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglry
rsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdg
asikfdsiclyatffpmahntastleamlrnd

Sequence, based on observed residues (ATOM records): (download)

>d2bvil1 b.121.2.2 (L:5-636) Adenovirus hexon, N-terminal domain {Human adenovirus type 5 [TaxId: 28285]}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
dgasikfdsiclyatffpmahntastleamlrnd

SCOPe Domain Coordinates for d2bvil1 are not available.

Timeline for d2bvil1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvil2