![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) ![]() duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
![]() | Family b.121.2.2: Adenovirus hexon [49753] (2 proteins) each domain is heavily decorated with many insertions |
![]() | Protein Adenovirus hexon [63404] (2 species) |
![]() | Species Human adenovirus type 5 [TaxId:28285] [49756] (3 PDB entries) |
![]() | Domain d2bvij2: 2bvi J:637-946 [129267] |
PDB Entry: 2bvi (more details), 10 Å
SCOPe Domain Sequences for d2bvij2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvij2 b.121.2.2 (J:637-946) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]} tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie tvylrtpfsa
Timeline for d2bvij2: