Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.2: Adenovirus hexon [49753] (3 proteins) each domain is heavily decorated with many insertions |
Protein Adenovirus hexon, C-terminal domain [418931] (2 species) |
Species Human adenovirus type 5 [TaxId:28285] [419365] (3 PDB entries) |
Domain d2bvih2: 2bvi H:637-946 [129263] Other proteins in same PDB: d2bvif1, d2bvig1, d2bvih1, d2bvii1, d2bvij1, d2bvik1, d2bvil1, d2bvim1, d2bvin1, d2bvio1, d2bvip1, d2bviq1 |
PDB Entry: 2bvi (more details), 10 Å
SCOPe Domain Sequences for d2bvih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvih2 b.121.2.2 (H:637-946) Adenovirus hexon, C-terminal domain {Human adenovirus type 5 [TaxId: 28285]} tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie tvylrtpfsa
Timeline for d2bvih2: