Lineage for d2bveb1 (2bve B:1-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653956Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 653957Species Mouse (Mus musculus) [TaxId:10090] [48733] (7 PDB entries)
  8. 653963Domain d2bveb1: 2bve B:1-111 [129257]
    automatically matched to d1od7a_
    complexed with ph5

Details for d2bveb1

PDB Entry: 2bve (more details), 2.2 Å

PDB Description: structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac
PDB Compounds: (B:) sialoadhesin

SCOP Domain Sequences for d2bveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bveb1 b.1.1.1 (B:1-111) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkg

SCOP Domain Coordinates for d2bveb1:

Click to download the PDB-style file with coordinates for d2bveb1.
(The format of our PDB-style files is described here.)

Timeline for d2bveb1: