SCOP 1.75: Domain d2bvea1: 2bve A:1-111

Lineage for d2bvea1 (2bve A:1-111)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein N-terminal domain of sialoadhesin [48732] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48733] (7 PDB entries)
   Uniprot Q62230 20-130

8. Domain d2bvea1: 2bve A:1-111 [129256]
   automatically matched to d1od7a_
   complexed with ph5

Details for d2bvea1

PDB Entry: 2bve, 2.2 Å

PDB Description: structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac

PDB Compounds: (A:) sialoadhesin

SCOP Domain Sequences for d2bvea1:

Sequence; same for both SEQRES and ATOM records:

>d2bvea1 b.1.1.1 (A:1-111) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkg

Timeline for d2bvea1:

• d2bvea1 first appeared in SCOP 1.73
  
• d2bvea1 is called d2bvea_ in SCOPe 2.01
  
• d2bvea1 appears in the current release, SCOPe 2.08, called d2bvea_