SCOPe 2.08: Domain d2bvea_: 2bve A:

Lineage for d2bvea_ (2bve A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2bvea_: 2bve A: [129256]
   automated match to d1qfoa_
   complexed with ph5

Details for d2bvea_

PDB Entry: 2bve, 2.2 Å

PDB Description: structure of the n-terminal of sialoadhesin in complex with 2-phenyl- prop5ac

PDB Compounds: (A:) sialoadhesin

SCOPe Domain Sequences for d2bvea_:

Sequence; same for both SEQRES and ATOM records:

>d2bvea_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

Timeline for d2bvea_:

• d2bvea_ first appeared in SCOP 1.73, called d2bvea1
  
• d2bvea_ appears in SCOPe 2.07