SCOPe 2.08: Domain d2bvda_: 2bvd A:

Lineage for d2bvda_ (2bvd A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187247] (4 PDB entries)

8. Domain d2bvda_: 2bvd A: [129255]
   automated match to d2bv9a1
   complexed with isx

Details for d2bvda_

PDB Entry: 2bvd, 1.6 Å

PDB Description: how family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides. structure and activity of a clostridium thermocellum lichenase, ctlic26a

PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d2bvda_:

Sequence; same for both SEQRES and ATOM records:

>d2bvda_ c.1.8.3 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
glkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilmi
twepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaigyssrvnt
netyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgynw
gttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirtsy
nkviaavwfhenketdwrinsspealaayreaigal

Timeline for d2bvda_:

• d2bvda_ first appeared in SCOP 1.73, called d2bvda1
  
• d2bvda_ appears in SCOPe 2.07