Lineage for d2bvcf2 (2bvc F:105-478)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2975032Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2975033Protein automated matches [227028] (6 species)
    not a true protein
  7. 2975118Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)
  8. 2975124Domain d2bvcf2: 2bvc F:105-478 [129254]
    Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
    automated match to d1f52a2
    complexed with adp, cl, mg, p3s

Details for d2bvcf2

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (F:) glutamine synthetase 1

SCOPe Domain Sequences for d2bvcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvcf2 d.128.1.0 (F:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d2bvcf2:

Click to download the PDB-style file with coordinates for d2bvcf2.
(The format of our PDB-style files is described here.)

Timeline for d2bvcf2: