Lineage for d2bvcc1 (2bvc C:4-104)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. Protein automated matches [226862] (5 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. Domain d2bvcc1: 2bvc C:4-104 [129247]
    Other proteins in same PDB: d2bvca2, d2bvcb2, d2bvcc2, d2bvcd2, d2bvce2, d2bvcf2
    automated match to d1f52a1
    complexed with adp, cl, mg, p3s

Details for d2bvcc1

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d2bvcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvcc1 d.15.9.0 (C:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d2bvcc1 are not available.

Timeline for d2bvcc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvcc2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bvca1, d2bvca2, d2bvcb1, d2bvcb2, d2bvcd1, d2bvcd2, d2bvce1, d2bvce2, d2bvcf1, d2bvcf2