SCOPe 2.08: Domain d2bv9a1: 2bv9 A:7-282

Lineage for d2bv9a1 (2bv9 A:7-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Endoglucanase H N-terminal domain [141783] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [141784] (2 PDB entries)
   Uniprot P16218 29-304! Uniprot P16218 31-304

8. Domain d2bv9a1: 2bv9 A:7-282 [129242]
   Other proteins in same PDB: d2bv9a2

Details for d2bv9a1

PDB Entry: 2bv9, 1.5 Å

PDB Description: how family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides. structure and activity of a clostridium thermocellum lichenase, ctlic26a

PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d2bv9a1:

Sequence; same for both SEQRES and ATOM records:

>d2bv9a1 c.1.8.3 (A:7-282) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]}
sglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilm
itwepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaigyssrvn
tnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgyn
wgttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirts
ynkviaavwfhenketdwrinsspealaayreaiga

Timeline for d2bv9a1:

• d2bv9a1 first appeared in SCOP 1.73
  
• d2bv9a1 appears in SCOPe 2.07