SCOPe 2.08: Domain d2bv3a5: 2bv3 A:600-688

Lineage for d2bv3a5 (2bv3 A:600-688)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)

8. Domain d2bv3a5: 2bv3 A:600-688 [129241]
   Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a3
   automatically matched to d1dar_4
   complexed with gnp, mg; mutant

Details for d2bv3a5

PDB Entry: 2bv3, 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a5:

Sequence; same for both SEQRES and ATOM records:

>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqekli

Timeline for d2bv3a5:

• d2bv3a5 first appeared in SCOP 1.73
  
• d2bv3a5 appears in SCOPe 2.07