![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
![]() | Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries) |
![]() | Domain d2bv3a5: 2bv3 A:600-688 [129241] Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a3 automatically matched to d1dar_4 complexed with gnp, mg; mutant |
PDB Entry: 2bv3 (more details), 2.5 Å
SCOPe Domain Sequences for d2bv3a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl rsktqgrgsfvmffdhyqevpkqvqekli
Timeline for d2bv3a5:
![]() Domains from same chain: (mouse over for more information) d2bv3a1, d2bv3a2, d2bv3a3, d2bv3a4 |