Lineage for d2bv3a4 (2bv3 A:404-478)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560339Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2560340Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2560396Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2560397Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 2560398Domain d2bv3a4: 2bv3 A:404-478 [129240]
    Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a3
    automatically matched to d1fnma4
    complexed with gnp, mg; mutant

Details for d2bv3a4

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a4:

Sequence, based on SEQRES records: (download)

>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeesptfsvsthpetgstiisgmgelsleiiv
drlkrefkvdanvgk

Sequence, based on observed residues (ATOM records): (download)

>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepsptfsvsthpetgstiisgmgelsleiivvgk

SCOPe Domain Coordinates for d2bv3a4:

Click to download the PDB-style file with coordinates for d2bv3a4.
(The format of our PDB-style files is described here.)

Timeline for d2bv3a4: