Lineage for d2bv3a4 (2bv3 A:404-478)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. Domain d2bv3a4: 2bv3 A:404-478 [129240]
    Other proteins in same PDB: d2bv3a1, d2bv3a2, d2bv3a3
    automatically matched to d1fnma4
    complexed with gnp, mg; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2bv3a4

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a4:

Sequence, based on SEQRES records: (download)

>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeesptfsvsthpetgstiisgmgelsleiiv
drlkrefkvdanvgk

Sequence, based on observed residues (ATOM records): (download)

>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepsptfsvsthpetgstiisgmgelsleiivvgk

SCOPe Domain Coordinates for d2bv3a4 are not available.

Timeline for d2bv3a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bv3a1, d2bv3a2, d2bv3a3, d2bv3a5