Lineage for d2bv0b_ (2bv0 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042822Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2042823Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)
  8. 2042826Domain d2bv0b_: 2bv0 B: [129236]
    Other proteins in same PDB: d2bv0a_
    automated match to d1eo2b_
    complexed with dhb, fe; mutant

Details for d2bv0b_

PDB Entry: 2bv0 (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h in complex with protocatechuate.
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2bv0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv0b_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOPe Domain Coordinates for d2bv0b_:

Click to download the PDB-style file with coordinates for d2bv0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bv0b_: