Lineage for d2bv0b1 (2bv0 B:303-540)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790969Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 790970Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (16 PDB entries)
  8. 790979Domain d2bv0b1: 2bv0 B:303-540 [129236]
    Other proteins in same PDB: d2bv0a1
    automatically matched to d1eo2b_
    complexed with dhb, fe; mutant

Details for d2bv0b1

PDB Entry: 2bv0 (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h in complex with protocatechuate.
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOP Domain Sequences for d2bv0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv0b1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOP Domain Coordinates for d2bv0b1:

Click to download the PDB-style file with coordinates for d2bv0b1.
(The format of our PDB-style files is described here.)

Timeline for d2bv0b1: