SCOPe 2.05: Domain d2buzb_: 2buz B:

Lineage for d2buzb_ (2buz B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)

8. Domain d2buzb_: 2buz B: [129235]
   Other proteins in same PDB: d2buza_
   automated match to d1eo2b_
   complexed with 4nc, fe; mutant

Details for d2buzb_

PDB Entry: 2buz, 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h in complex with 4-nitrocatechol

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2buzb_:

Sequence; same for both SEQRES and ATOM records:

>d2buzb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d2buzb_:

• d2buzb_ first appeared in SCOP 1.73, called d2buzb1
  
• d2buzb_ appears in SCOPe 2.04
  
• d2buzb_ appears in SCOPe 2.06
  
• d2buzb_ appears in the current release, SCOPe 2.08