SCOPe 2.08: Domain d2buwa_: 2buw A:

Lineage for d2buwa_ (2buw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein automated matches [190232] (2 species)
   not a true protein

7. Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)

8. Domain d2buwa_: 2buw A: [129232]
   automated match to d1eo2a_
   complexed with fe, phb; mutant

Details for d2buwa_

PDB Entry: 2buw, 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with 4-hydroxybenzoate

PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buwa_:

Sequence; same for both SEQRES and ATOM records:

>d2buwa_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d2buwa_:

• d2buwa_ first appeared in SCOP 1.73, called d2buwa1
  
• d2buwa_ appears in SCOPe 2.07