SCOP 1.75: Domain d2buva1: 2buv A:4-200

Lineage for d2buva1 (2buv A:4-200)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (16 PDB entries)

8. Domain d2buva1: 2buv A:4-200 [129231]
   Other proteins in same PDB: d2buvb1
   automatically matched to d1eo2a_
   complexed with dhb, fe; mutant

Details for d2buva1

PDB Entry: 2buv, 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with protocatechuate

PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOP Domain Sequences for d2buva1:

Sequence; same for both SEQRES and ATOM records:

>d2buva1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d2buva1:

• d2buva1 first appeared in SCOP 1.73
  
• d2buva1 is called d2buva_ in SCOPe 2.01
  
• d2buva1 appears in the current release, SCOPe 2.08, called d2buva_