Lineage for d2buva1 (2buv A:4-200)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660221Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 660222Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (12 PDB entries)
  8. 660227Domain d2buva1: 2buv A:4-200 [129231]
    automatically matched to d1eo2a_
    complexed with dhb, fe; mutant

Details for d2buva1

PDB Entry: 2buv (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with protocatechuate
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOP Domain Sequences for d2buva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buva1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOP Domain Coordinates for d2buva1:

Click to download the PDB-style file with coordinates for d2buva1.
(The format of our PDB-style files is described here.)

Timeline for d2buva1: