| Class b: All beta proteins [48724] (176 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein automated matches [190232] (2 species) not a true protein |
| Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries) |
| Domain d2buua_: 2buu A: [129230] automated match to d1eo2a_ complexed with 4nc, fe; mutant |
PDB Entry: 2buu (more details), 1.8 Å
SCOPe Domain Sequences for d2buua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buua_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi
Timeline for d2buua_: