Lineage for d2buua_ (2buu A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 940123Protein automated matches [190232] (2 species)
    not a true protein
  7. 940124Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 940129Domain d2buua_: 2buu A: [129230]
    automated match to d1eo2a_
    complexed with 4nc, fe; mutant

Details for d2buua_

PDB Entry: 2buu (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with 4-nitrocatechol
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buua_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d2buua_:

Click to download the PDB-style file with coordinates for d2buua_.
(The format of our PDB-style files is described here.)

Timeline for d2buua_: