![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
![]() | Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (12 PDB entries) |
![]() | Domain d2buua1: 2buu A:4-200 [129230] automatically matched to d1eo2a_ complexed with 4nc, fe; mutant |
PDB Entry: 2buu (more details), 1.8 Å
SCOP Domain Sequences for d2buua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buua1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd gevvyrfdiriqgenetvffdi
Timeline for d2buua1: