![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
![]() | Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (16 PDB entries) |
![]() | Domain d2burb1: 2bur B:303-540 [129228] Other proteins in same PDB: d2bura1 automatically matched to d1eo2b_ complexed with fe, phb |
PDB Entry: 2bur (more details), 1.8 Å
SCOP Domain Sequences for d2burb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2burb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt
Timeline for d2burb1: