SCOP 1.73: Domain d2burb1: 2bur B:303-540

Lineage for d2burb1 (2bur B:303-540)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (12 PDB entries)

8. Domain d2burb1: 2bur B:303-540 [129228]
   Other proteins in same PDB: d2bura1
   automatically matched to d1eo2b_
   complexed with fe, phb

Details for d2burb1

PDB Entry: 2bur, 1.8 Å

PDB Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 in complex with 4-hydroxybenzoate

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOP Domain Sequences for d2burb1:

Sequence; same for both SEQRES and ATOM records:

>d2burb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d2burb1:

• d2burb1 is new in SCOP 1.73
  
• d2burb1 appears in SCOP 1.75
  
• d2burb1 appears in the current release, SCOPe 2.08, called d2burb_