Lineage for d2bura_ (2bur A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2043015Protein automated matches [190232] (2 species)
    not a true protein
  7. 2043016Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 2043017Domain d2bura_: 2bur A: [129227]
    Other proteins in same PDB: d2burb_
    automated match to d1eo2a_
    complexed with fe, phb

Details for d2bura_

PDB Entry: 2bur (more details), 1.8 Å

PDB Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 in complex with 4-hydroxybenzoate
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2bura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bura_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d2bura_:

Click to download the PDB-style file with coordinates for d2bura_.
(The format of our PDB-style files is described here.)

Timeline for d2bura_: