Lineage for d2buqa_ (2buq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2380088Protein automated matches [190232] (2 species)
    not a true protein
  7. 2380089Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 2380091Domain d2buqa_: 2buq A: [129225]
    Other proteins in same PDB: d2buqb_
    automated match to d1eo2a_
    complexed with caq, fe

Details for d2buqa_

PDB Entry: 2buq (more details), 1.8 Å

PDB Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 in complex with catechol
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buqa_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d2buqa_:

Click to download the PDB-style file with coordinates for d2buqa_.
(The format of our PDB-style files is described here.)

Timeline for d2buqa_: