Lineage for d2buna1 (2bun A:5-125)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028717Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1028750Family d.58.10.2: BLUF domain [143364] (4 proteins)
    Pfam PF04940; sensors of blue-light using FAD
  6. 1028767Protein Sensor of blue light AppA [143367] (1 species)
  7. 1028768Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries)
    Uniprot Q53119 17-130! Uniprot Q53119 5-125
  8. 1028770Domain d2buna1: 2bun A:5-125 [129223]
    complexed with fad

Details for d2buna1

PDB Entry: 2bun (more details)

PDB Description: solution structure of the bluf domain of appa 5-125
PDB Compounds: (A:) appa

SCOPe Domain Sequences for d2buna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buna1 d.58.10.2 (A:5-125) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]}
leadvtmtgsdlvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqw
leghpaavaevmshiqrdrrhsnveilaeesiakrrfagwhmqlscseadmrslglaesr
q

SCOPe Domain Coordinates for d2buna1:

Click to download the PDB-style file with coordinates for d2buna1.
(The format of our PDB-style files is described here.)

Timeline for d2buna1: