Lineage for d2bumb_ (2bum B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)
  8. Domain d2bumb_: 2bum B: [129222]
    Other proteins in same PDB: d2buma_
    automated match to d1eo2b_
    complexed with fe, oh

Details for d2bumb_

PDB Entry: 2bum (more details), 1.8 Å

PDB Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2bumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bumb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOPe Domain Coordinates for d2bumb_ are not available.

Timeline for d2bumb_:

Domains from other chains:
(mouse over for more information)
d2buma_