SCOPe 2.02: Domain d2buma_: 2bum A:

Lineage for d2buma_ (2bum A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein automated matches [190232] (2 species)
   not a true protein

7. Species Acinetobacter sp. [TaxId:62977] [186996] (1 PDB entry)

8. Domain d2buma_: 2bum A: [129221]
   Other proteins in same PDB: d2bumb_
   automated match to d1eo2a_
   complexed with fe, oh

Details for d2buma_

PDB Entry: 2bum, 1.8 Å

PDB Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1

PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buma_:

Sequence; same for both SEQRES and ATOM records:

>d2buma_ b.3.6.1 (A:) automated matches {Acinetobacter sp. [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d2buma_:

• d2buma_ first appeared in SCOP 1.73, called d2buma1
  
• d2buma_ appears in SCOPe 2.01
  
• d2buma_ appears in SCOPe 2.03
  
• d2buma_ appears in the current release, SCOPe 2.08