Lineage for d2buka1 (2buk A:12-195)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679605Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 680309Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 680310Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 680321Protein STNV coat protein [49621] (1 species)
  7. 680322Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (1 PDB entry)
  8. 680323Domain d2buka1: 2buk A:12-195 [129220]
    automatically matched to d2stv__
    complexed with ca

Details for d2buka1

PDB Entry: 2buk (more details), 2.45 Å

PDB Description: satellite tobacco necrosis virus
PDB Compounds: (A:) coat protein

SCOP Domain Sequences for d2buka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buka1 b.121.7.1 (A:12-195) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

SCOP Domain Coordinates for d2buka1:

Click to download the PDB-style file with coordinates for d2buka1.
(The format of our PDB-style files is described here.)

Timeline for d2buka1: