Lineage for d2buka_ (2buk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823761Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 2823762Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 2823770Protein STNV coat protein [49621] (1 species)
  7. 2823771Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (8 PDB entries)
  8. 2823858Domain d2buka_: 2buk A: [129220]
    automated match to d2stv__
    complexed with ca

Details for d2buka_

PDB Entry: 2buk (more details), 2.45 Å

PDB Description: satellite tobacco necrosis virus
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2buka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buka_ b.121.7.1 (A:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

SCOPe Domain Coordinates for d2buka_:

Click to download the PDB-style file with coordinates for d2buka_.
(The format of our PDB-style files is described here.)

Timeline for d2buka_: