SCOPe 2.08: Domain d2buid2: 2bui D:254-405

Lineage for d2buid2 (2bui D:254-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d2buid2: 2bui D:254-405 [129219]
   Other proteins in same PDB: d2buia1, d2buib1, d2buic1, d2buid1
   automated match to d1fj4a2
   complexed with nh4, oca

Details for d2buid2

PDB Entry: 2bui, 2.4 Å

PDB Description: e.coli beta-ketoacyl (acyl carrier protein) synthase i in complex with octanoic acid, 120k

PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2buid2:

Sequence; same for both SEQRES and ATOM records:

>d2buid2 c.95.1.1 (D:254-405) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklk

Timeline for d2buid2:

• d2buid2 first appeared in SCOP 1.73
  
• d2buid2 appears in SCOPe 2.07