Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (8 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Protein phosphatase 5 [48454] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries) |
Domain d2buga1: 2bug A:18-147 [129203] complexed with ace; mutant |
PDB Entry: 2bug (more details)
SCOP Domain Sequences for d2buga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buga1 a.118.8.1 (A:18-147) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} dppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtec ygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyq ecnkivkqka
Timeline for d2buga1: