Lineage for d2buga1 (2bug A:18-147)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647285Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 647348Protein Protein phosphatase 5 [48454] (1 species)
  7. 647349Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)
  8. 647355Domain d2buga1: 2bug A:18-147 [129203]
    complexed with ace; mutant

Details for d2buga1

PDB Entry: 2bug (more details)

PDB Description: solution structure of the tpr domain from protein phosphatase 5 in complex with hsp90 derived peptide
PDB Compounds: (A:) serine/threonine protein phosphatase 5

SCOP Domain Sequences for d2buga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buga1 a.118.8.1 (A:18-147) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
dppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtec
ygyalndatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyq
ecnkivkqka

SCOP Domain Coordinates for d2buga1:

Click to download the PDB-style file with coordinates for d2buga1.
(The format of our PDB-style files is described here.)

Timeline for d2buga1: