Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein automated matches [190527] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187490] (1 PDB entry) |
Domain d2bufh_: 2buf H: [129198] Other proteins in same PDB: d2bufa1 automated match to d2bufa1 complexed with adp, cl, mg, nlg |
PDB Entry: 2buf (more details), 2.95 Å
SCOPe Domain Sequences for d2bufh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bufh_ c.73.1.2 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisn
Timeline for d2bufh_: