Lineage for d2bufe_ (2buf E:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. Protein automated matches [190527] (4 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [187490] (1 PDB entry)
  8. Domain d2bufe_: 2buf E: [129195]
    Other proteins in same PDB: d2bufa1
    automated match to d2bufa1
    complexed with adp, cl, mg, nlg

Details for d2bufe_

PDB Entry: 2buf (more details), 2.9499999999999997 Å

PDB Description: arginine feed-back inhibitable acetylglutamate kinase
PDB Compounds: (E:) acetylglutamate kinase

SCOPe Domain Sequences for d2bufe_:

Sequence, based on SEQRES records: (download)

>d2bufe_ c.73.1.2 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrk

Sequence, based on observed residues (ATOM records): (download)

>d2bufe_ c.73.1.2 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtiidighvgevtgvnvgllnmlvkgdfipviapigvgsng
esyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiygg
mlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrk

SCOPe Domain Coordinates for d2bufe_ are not available.

Timeline for d2bufe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bufa1, d2bufb_, d2bufc_, d2bufd_, d2buff_, d2bufg_, d2bufh_, d2bufi_, d2bufj_, d2bufk_, d2bufl_