Lineage for d2bufa1 (2buf A:2-301)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138082Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 protein domains)
  6. 2138083Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 2138097Species Pseudomonas aeruginosa [TaxId:287] [142718] (2 PDB entries)
    Uniprot Q9HTN2 1-300
  8. 2138098Domain d2bufa1: 2buf A:2-301 [129191]
    Other proteins in same PDB: d2bufb_, d2bufc_, d2bufd_, d2bufe_, d2buff_, d2bufg_, d2bufh_, d2bufi_, d2bufj_, d2bufk_, d2bufl_
    complexed with adp, cl, mg, nlg

Details for d2bufa1

PDB Entry: 2buf (more details), 2.95 Å

PDB Description: arginine feed-back inhibitable acetylglutamate kinase
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d2bufa1:

Sequence, based on SEQRES records: (download)

>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh

Sequence, based on observed residues (ATOM records): (download)

>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqiidighvgevtgvnvgllnmlvkgdfipviapigvgs
ngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvneliadgtiy
ggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh

SCOPe Domain Coordinates for d2bufa1:

Click to download the PDB-style file with coordinates for d2bufa1.
(The format of our PDB-style files is described here.)

Timeline for d2bufa1: