Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.3: Chromo barrel domain [117157] (4 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
Protein Putative histone acetyltransferase MOF [141223] (1 species) Males-absent on the first protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141224] (1 PDB entry) Uniprot O02193 367-454 |
Domain d2buda1: 2bud A:367-454 [129190] |
PDB Entry: 2bud (more details)
SCOPe Domain Sequences for d2buda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dplmqkidisenpdkiyfirredgtvhrgqvlqsrttenaaapdeyyvhyvglnrrldgw vgrhrisdnaddlggitvlpapplapdq
Timeline for d2buda1: