Lineage for d2buad1 (2bua D:39-508)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2810010Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2810011Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2810018Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2810261Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)
  8. 2810281Domain d2buad1: 2bua D:39-508 [129176]
    Other proteins in same PDB: d2buaa2, d2buab2, d2buac2, d2buad2
    automated match to d1orva1
    complexed with 007, nag, so4

Details for d2buad1

PDB Entry: 2bua (more details), 2.56 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a low molecular weight inhibitor.
PDB Compounds: (D:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2buad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buad1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d2buad1:

Click to download the PDB-style file with coordinates for d2buad1.
(The format of our PDB-style files is described here.)

Timeline for d2buad1: