Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins) Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit |
Protein Primitive phytochelatin synthase [142868] (1 species) |
Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries) Uniprot Q8YY76 29-238 |
Domain d2bu3b_: 2bu3 B: [129168] automated match to d2btwa1 complexed with 3gc, ca, cl |
PDB Entry: 2bu3 (more details), 1.4 Å
SCOPe Domain Sequences for d2bu3b_:
Sequence, based on SEQRES records: (download)
>d2bu3b_ d.3.1.14 (B:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]} nligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginapetaq yspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtnied frkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvw vkttdlwkamntvdsvsqktrgfvfvsk
>d2bu3b_ d.3.1.14 (B:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]} nligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginapyspy rvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkq vaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvwvktt dlwkamntvdsvsqktrgfvfvsk
Timeline for d2bu3b_: