Lineage for d2bu3b1 (2bu3 B:32-238)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015441Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
    Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit
  6. 1015442Protein Primitive phytochelatin synthase [142868] (1 species)
  7. 1015443Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries)
    Uniprot Q8YY76 29-238
  8. 1015445Domain d2bu3b1: 2bu3 B:32-238 [129168]
    automatically matched to 2BTW A:29-238
    complexed with 3gc, ca, cl

Details for d2bu3b1

PDB Entry: 2bu3 (more details), 1.4 Å

PDB Description: acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4
PDB Compounds: (B:) alr0975 protein

SCOPe Domain Sequences for d2bu3b1:

Sequence, based on SEQRES records: (download)

>d2bu3b1 d.3.1.14 (B:32-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
nligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginapetaq
yspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtnied
frkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvw
vkttdlwkamntvdsvsqktrgfvfvs

Sequence, based on observed residues (ATOM records): (download)

>d2bu3b1 d.3.1.14 (B:32-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
nligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginapyspy
rvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkq
vaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvwvktt
dlwkamntvdsvsqktrgfvfvs

SCOPe Domain Coordinates for d2bu3b1:

Click to download the PDB-style file with coordinates for d2bu3b1.
(The format of our PDB-style files is described here.)

Timeline for d2bu3b1: