SCOPe 2.03: Domain d2bu3a_: 2bu3 A:

Lineage for d2bu3a_ (2bu3 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
   Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit

6. Protein Primitive phytochelatin synthase [142868] (1 species)

7. Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries)
   Uniprot Q8YY76 29-238

8. Domain d2bu3a_: 2bu3 A: [129167]
   automated match to d2btwa1
   complexed with 3gc, ca, cl

Details for d2bu3a_

PDB Entry: 2bu3, 1.4 Å

PDB Description: acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4

PDB Compounds: (A:) alr0975 protein

SCOPe Domain Sequences for d2bu3a_:

Sequence, based on SEQRES records:

>d2bu3a_ d.3.1.14 (A:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvsk

Sequence, based on observed residues (ATOM records):

>d2bu3a_ d.3.1.14 (A:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginayr
vftqdnffstkaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkqvaen
lkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvwvkttdlwk
amntvdsvsqktrgfvfvsk

Timeline for d2bu3a_:

• d2bu3a_ first appeared in SCOP 1.73, called d2bu3a1
  
• d2bu3a_ was called d2bu3a1 in SCOPe 2.02
  
• d2bu3a_ appears in SCOPe 2.04
  
• d2bu3a_ appears in the current release, SCOPe 2.08