SCOP 1.73: Domain d2bu1b1: 2bu1 B:1-129

Lineage for d2bu1b1 (2bu1 B:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)

8. Domain d2bu1b1: 2bu1 B:1-129 [129165]
   automatically matched to d1dzsa_
   complexed with 5bu

Details for d2bu1b1

PDB Entry: 2bu1, 2.2 Å

PDB Description: ms2-rna hairpin (5bru -5) complex

PDB Compounds: (B:) ms2 coat protein

SCOP Domain Sequences for d2bu1b1:

Sequence; same for both SEQRES and ATOM records:

>d2bu1b1 d.85.1.1 (B:1-129) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d2bu1b1:

• d2bu1b1 is new in SCOP 1.73
  
• d2bu1b1 appears in SCOP 1.75
  
• d2bu1b1 appears in the current release, SCOPe 2.08, called d2bu1b_